SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|95288|fgenesh3_pg.16__149 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|95288|fgenesh3_pg.16__149
Domain Number - Region: 323-385
Classification Level Classification E-value
Superfamily RING/U-box 0.00101
Family U-box 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|95288|fgenesh3_pg.16__149
Sequence length 388
Sequence
MSTSKLNIEGVMLFEQPFARVPYENYRKVFRASQRNVEKELGAVQSSANDLAKRSKARNN
STEESIKAVDSMITRVENLKRKLSELQSSAGTPTLGVMRERLQHLGAVEDIPSVNEPEFT
RWADTRLDRWLVDWALRTGKEKTARMIAEDRGIERLVDIDLFSDVCRIEEGLKRQSCSEA
LAWCSENKSSLRKLKEYIELARARKNEDAIAYSKKHLLPWQETHLAQIRQAAALLCFPPT
TTCGPYKRLYDPARWTTLVQSFRLAVYNLSTLPTEPLLHLAVYAGLASLKLPACYDRHTK
NTNCPVCDPNLGELAKEVPYSHHVNSTIVCRMSGKIMDADNMPMAFPNGYVYSKEALEEM
ALRDDGYVTCPRTGERCLFSELRKVFIS
Download sequence
Identical sequences B8P3M6
104341.JGI95288 jgi|Pospl1|95288|fgenesh3_pg.16__149 XP_002470255.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]