SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|95535|fgenesh3_pg.56__53 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|95535|fgenesh3_pg.56__53
Domain Number 1 Region: 889-923
Classification Level Classification E-value
Superfamily RING/U-box 0.00000751
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|95535|fgenesh3_pg.56__53
Domain Number - Region: 66-245
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00112
Family WD40-repeat 0.064
Further Details:      
 
Domain Number - Region: 851-902
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0589
Family Rad50 coiled-coil Zn hook 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|95535|fgenesh3_pg.56__53
Sequence length 1092
Sequence
MYTGNVEHASAPGLSYGTLPQVQYEGFEPSPYEEEEAQMNSIGLADQPDVAPAAPLFDLS
RVQYTLPAPLMSLVVSSDVLSMGLSNNFIVQIELSRSEQVVKIPIPRKPTEFLIHKLFLD
PSGRHLLVTSLTGENWYLYRGWKKPKQLKNFKMVIESVAWNKAALLASAHSTSTREILIG
ARNGTIYEAMLDAEEDFFKSQERYCQPVLTLPERQPVTGLKFEFFPPSDPRKALVIVTTP
SRIYQFVGAPDRRSDDNGRVFLGLFASYRDSPQKFSELPGNVDYSELHTYGSDAGQANSL
PRSLAWMTTPGIYHGMLNFESTSDDLIDGAQLLPYPVLTSPSASPAQASGSLDVPLSMAL
TEFHFVLLYHDRVVSLSSLNEQMSYEEMLPVKPNEGVKGMAADPVRGTYWVYTDQSLFEL
VVTNEHRDVWRIYLDKGNYDAALRYAKTASQRDHVMSAQARAFFDEGRYFQAAQCYAQCS
VSFEEVTLKFLDVGERDALRSYLTSRLERTKKTDISQRMMLATWLVEFYLSKCNELDDLI
ASESVSHDVDNLHAERTILEDDLRQFLQTYKANLDPKTVYELILGHGRTDMYLHYATVIS
DLERVVEHWIMEEEWAKAIDVINRQSNLELYYRFGPVLIRQAPKETVDSWLRQQALVPLR
LVPALLRLQHAPRDPLSPNQAVRYLNHVIFERGNTSPTIHNLMITFYAFVPSSSSGSSSA
SHSDDDGPLLRFLSSAPSDPLTGKPYYDLDYALRLCKQAGRTQPCVHIYSKMGLYECSVD
LALEKGDLELAKINADMPEDDEQLRKKLWLKIAKAMRFLENTDLLKIEDILPFFPDFVVI
DDFKDEICNALEGYAAHIDTLKADMDEATRNAEAIKQDIAALSKRFITIDSTEKCSVCGQ
ALFTRQFYVFPCQHTFHADCLIGLTKEFLPSHALRRILALQNELVKSSQKGPLDRSAITN
PTLGAGTPPPRQPAVQRTLLSANFGIGQGHTRGANSLGRNLLSAGDRLRDLISPDTLASV
VTAPAGWIPGIGTGAGAGAKRGGGEKDAEKTERLRRELEDVLAASCPLCESVVAGLDKPF
VQPGEVDASWAL
Download sequence
Identical sequences A0A1X6NG37 B8P9R2
XP_002472406.1.31404 jgi|Pospl1|95535|fgenesh3_pg.56__53 104341.JGI95535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]