SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|96483|fgenesh3_pg.5__130 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|96483|fgenesh3_pg.5__130
Domain Number 1 Region: 4-60
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000685
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|96483|fgenesh3_pg.5__130
Sequence length 349
Sequence
MRAHCSICQDSHLLQEFRFLPCGHGFCLPSLEHYVQQHTRKPCPICRVFFRLSDVLAVFI
EGDPDAPRSQAAPASDAANDPPYPAAVLRQAAQKEQLTALQSDLRAAGTEKDALRQDAEH
ARCLASSAVDTADKARHELVGAREEAERLRRRVEAQGRQHREQLAAKAKEARGLWDTVLA
HKDKEAKQKAKIAALRQQVGEHEATIGLLRSRAIAPARRARWRGSERSTPTPAFNPDEDL
EILDAYPTQDNTPLTDTTSNSDLGFLDPDSSRPLPPLFPTPCSQPSFPAPATPQRPIFGT
DWNLKPPEKRRRVVSADTRPSTSFPIAVDEKGRPKGAVQLGSRQKLKFG
Download sequence
Identical sequences B8P0Q2
XP_002469282.1.31404 104341.JGI96483 jgi|Pospl1|96483|fgenesh3_pg.5__130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]