SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|96798|fgenesh3_pg.46__63 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|96798|fgenesh3_pg.46__63
Domain Number 1 Region: 715-807
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.33e-25
Family Chaperone J-domain 0.00039
Further Details:      
 
Domain Number 2 Region: 540-662
Classification Level Classification E-value
Superfamily TPR-like 5.2e-18
Family Tetratricopeptide repeat (TPR) 0.0058
Further Details:      
 
Domain Number 3 Region: 210-276
Classification Level Classification E-value
Superfamily UBA-like 0.0000000479
Family UBA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|96798|fgenesh3_pg.46__63
Sequence length 822
Sequence
MSDSFADLWNSTGAATTKPSESSRKSGSLTPVVPPSRNAQNDVFSMLASAGTSSPASRTA
SNSANGARMTIAERAAQAERERQLQIRQQQAKAKQQASAWAGLDSLGEFTSRPSSTSQPA
VSADSDWGFGLEATTASTSSGTANAAPVSQNDWGLDDFISQPAPSKPVAAPQTSSLLDLD
EFTSPSTVQPQRYTPDVRSNTPGDFDFGDREDRLLSDHSDEDDILGELSKPVTERPAQPI
VEMGFSIQQARVALAATDTGLDVQAALETLLSNGAASDSQPSERPREDQRNAQREPGWER
YYESDEDQPRSTSSGRRTAPTSRSTAPNRASEPTARDGPSPSGDSQRHLQEQADKLIAQA
SEIGLSMFNRANAFWKEGKEKVQRAYEERAATAARTGEGGSRNGRPKWMQEVPEGEGGEG
ERTKADRNGFRDDDEVLPPKPSRPATQPRSKQTDARPPESQPSTSERAKVGNLFSDDPPV
VYTSPFRRKAPARNPALMPAAPAKVTSSVRPTPPRAPSPIPLVQRKTVSASPAAITSSAQ
HKAKGTEMFKLGRYAEAETAYSAAISGLPSAHLLLIPLYNNRALARIKTGDHNGAIEDCT
TVIELIGPEYHPAREAKVTKEDEGASVDLAEGMVKALWRRAEAYEGREKWDAARKDWEAV
ASVEWAGKARMEAVRGAGRCKQMLNADANGGAPSAPKSRPAAKPKPRPSRPPVAVPTEAL
NRVREANQAAEAEDQARHELKDVVDARLVAWKNGKETNIRALIASLETVLWPELGWKKVG
MHELVTPAQVKIRYTKAIAKLHPDKARFQPLSRRVLTRRHLL
Download sequence
Identical sequences B8P8F3
104341.JGI96798 XP_002471962.1.31404 jgi|Pospl1|96798|fgenesh3_pg.46__63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]