SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|97158|fgenesh3_pg.32__57 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|97158|fgenesh3_pg.32__57
Domain Number 1 Region: 2046-2214,2242-2353
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.14e-68
Family Protein kinases, catalytic subunit 0.0000351
Further Details:      
 
Domain Number 2 Region: 1314-1458
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.15e-21
Family Tandem AAA-ATPase domain 0.0064
Further Details:      
 
Domain Number 3 Region: 283-316,362-456,522-597
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.51e-20
Family Tandem AAA-ATPase domain 0.01
Further Details:      
 
Domain Number 4 Region: 1230-1266
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000972
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|97158|fgenesh3_pg.32__57
Sequence length 2759
Sequence
MRQETSYHSLSLHHGVHAQNVLNVNALLTCLKRPKGKKRAAPTAPDRPRKKARRPRTEDK
APSSEDDEPKQFLVCEHTFELQYKWSEDEVARKVDEGGALAHSQKGVAEVMSKIGSQATD
LGMLVLRSGSFASAGRIVALQAYTETGSYVLTLPDITFDFDAAAHDLRLSYLSDPLVACH
RLSSAGRAVISARASLHPEPTADKSQLPFRIRVEISVSLNYPSIVKQVPSSVHNRVNEVD
EAQRRVLWHVFPPCNSPPAGFAGNIDVSLLFSILGRAPPIAHDHHVQPQDLRPTLLPFQR
RSVAWMLSREGQTLSESGSVEPSAASRSSSLFWEETQVEDEKWYVNRLRGVVSRTKPDED
EDALGGILAEEPGLGKTLECIALIMLNPAIGRGPVNKRWDEEAKVYVKEIKTTLIVTPAS
LAPQWVDEFKLHAPTLKVLVYDGWQKVHGQGKETSGKQKATREGRGGQSGAKARREAKKK
AKVAATSHAGSDIETGETGPSAKLDEEVDGIVDWCTYVNTFDVCITTYNVLQQDLSVARP
PPVRPRRETALYTTSAHARSPLITCEWYRVIMDEVQMVGGGRTHFLRVSTISNNPRLWSR
LLLPSYVNDFVSLFRRYAIRTVKTEVQDELTIPAQTRYLVPIEQGPVERHVYTQNFYNAC
LDLGLDVRGIAVREDWEADTTVLRAWLRKLRGICTHPQVGQLSNRADRQHKSKGIKSMSE
VLEDMRQQNWRDLMEDRRYKVQQLARIAQLEQVVKDNANRYQIALQTLLAAEKDARLLVN
DVQTALAEHLKQEASLEASRNARTSQNDHSENSGKGKGRARNDDASGNLSSLSDDESVPF
NKAGEEHMARRAALQNRLRDCRVILHQVLFFKANVYNILGESHADAEIEAYAAAEELRRL
VLKGTEETAARAMEQLKSNPSIRELKNSELDIAVPYLDKGGPRSADLMEEANEFIESLLN
EQSALIWEWRQKLIKLLTQSLTSKDEDEDADGQEYARSIDTQGEAEAYLEAYAALLSDRR
EALTAERTLLAAHDTKEAHIRRTKAAKKASRLIGVEMEAGEDGFKLQQHLAEQDVRPEIE
LLRKSLRDERKALTEDFAPGRALKSIVVDLQAVIARIHKVIDPEKELVRGAVRQLRDLIV
EQCMPLLSPVLFGPANSHPAKLMDRLHSDLVQLRKAFNERISYFRQLQEISDSVTEVEFD
GVLSDVIETARGRTDGPGYPDQYRCEFSRGHITPCAHIFCETCLKGWLARKEGKVCPVCR
KGIDTDQLQRFSLKKKEDDEQLLPRKLVNNELPKSHRRIEYNFIDKRLLEDIQTMESLGN
YGSKIQTVVRHLLYLELSDPGSKTIVFSAWADSLLMLKLWSGISCLRIDQHSGKENAAKR
FRTDSSISVLLLHGERENAGLNVTCASRVFLVESVVNHAFELQAIARIDRMGQLRPTEVY
CYYTEDTVEKSILDLAAKQGQSLYTRDNSAGTLNVAPFALASSKNAIDSPAKKKQKGDFV
FKLRHGLEYYALNLRVRDRRRKIVTFSQLDQKQLTIEWWRRTGRALMPRPTSTLQLSDYP
PTVYSTITILSPQVIETPMSGSESEVPRPVQSTLLPSYPWSTALQITSPQTDVRQWENDW
VRAIDRVTKQGPVELFQSMCKLWDRCGEREREHVVKMRSELAKLQKQVVLWFVDIRVAMG
CAFEEIWMLLNDGYRRYYISEGLLRAGSVGHWEEEARVLCPELTEANLALPDGQAMIDFM
YHAYLEACRTRDSGSDVFLVANPWWDMLDVYLGRPLPEKENLVLDALAIIRNQYISEFVY
GWLENLVHDIAERQESMPFLTHLFRRDPVRTAKSVINTPYRITAQSDSSSMYCAGCVGTR
KEFEKSDNVRYPIGQGTDTSASLVLKLRSCGRGSLNARIGYAPSYWWLKGSSQSILRSIT
PIWMWTRRPAQFRMPTSVTGLYSSFRKWRTLPMLSTTHGSKKLVYATCAVHPDGQRSPLS
VSLSLVKMGLKNLFMRVTNSLAITFVSFKIAPGKEVEATLSQAEPDAQTMLDTFVLNKPA
ASFIDDIHVRMRFDEDGEMASDFRPIKKLGKGGQGTVLLVDDKVTGTRLSMKVIRKKDVL
LRHYPGIFQEQYVMKTMSGSAWVLSLLGSFHDSDNFYFLTEYMSGGDLFSKMKWKRKLLA
PTALQYAAELVFAIGVLHENRILHRDIKQDNALLDANDHLVLADFGFTKAFGHPRSETLW
KSSHDWGCEDDNSEGGVEEDHTKSRCGTRGFMAPEIYYGPEYSYPADIWAAGVTIFMMLN
GRFPFGMTMDMGLAELFRRSKTLPVRFGPSANVSEDARHLITWMLEKDPIERPTIAEIKG
HPYFSSIDWGQLARRERASGENIDARAREVKKQLAMETKDEKFLCDHGIRGSSGWWTKKS
SSETLILKFLGCVRPPDVCDLRRLRTAALQTGQGYPLWEPEPKDGIEVEIGDVGYLHRGG
FYRIFNALRDPQDPLNATLGTPPDFEKFSSGAMQPHRVENAIASGPVASKTLRKISVTGE
LSVHNIGATCKYECTDDQGALLVLETPAVREELHQLRRLKNYFSKNINDWHTFAAGEIGL
EKKPEEILFVRGWVKTTRWAVAAFTNQAKSAKISFDGNFASPATASFALEASESIAPQHD
RRSGPEDRLRGEGHHHARIQQQQHQQRQRGRIRGQGGKNHNSTRSSEGEPAWPADQCVFL
HYLKLKKRFLLLKTIEAAAEPQDPSVSGDDDDTIEEVPARIQIQDPVDEVLDYILRVGT
Download sequence
Identical sequences B8P676
104341.JGI97158 jgi|Pospl1|97158|fgenesh3_pg.32__57 XP_002471203.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]