SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|98475|fgenesh3_pg.130__10 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|98475|fgenesh3_pg.130__10
Domain Number 1 Region: 478-523,560-587
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000122
Family UBX domain 0.047
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|98475|fgenesh3_pg.130__10
Domain Number - Region: 237-329
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000179
Family Glutathione peroxidase-like 0.082
Further Details:      
 
Domain Number - Region: 7-49
Classification Level Classification E-value
Superfamily UBA-like 0.000248
Family UBA domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|98475|fgenesh3_pg.130__10
Sequence length 628
Sequence
MDVETLSQSQREAVSQLQALMNGADADVAVDVLESVDWDVQRAANMILDTGVPEAASATT
TNTRMESFEIDDSEQQGLLRPNNSGRQFRPVNECVKNAQQSNAVTVRPLRAIIAFFALPF
RLITSVLRFVFRLLRIPIPQFVPFTWSNLTYRPLGSSSGHEARAMDPKSVAERWVRALEE
ETGAVCISRSGRRGDSVSSSNGHGISSGADVAGPSVLTSRSGAHDASADADSGSKRLPGF
FLGSYEHFARMCEKEAKVGCIIIVSDEHDDVAEFKSLWVVRSTLTDPTFVKLIQENDILV
WGGDIRDKDAWSAAQKLQTTTYPFVAFIALQPRRSAASGASSTPTLTILSRHQGPSIPSI
TAPTAAQTLVTHLNEQIFPRVKPFLARIHAQTAERERERALRAEQDRAFEESRRRDKERV
ERRMKEEREAEEERLRHAQAEERAKQDAHRLEEVRKDWEARRMVWRRYERKALVMREPRP
GGEAGRGRTMRVGLRMPDGRRIVRFFGEADSMTALYAYVDSQFIPAELSQASDPKEPPSG
LAPGEEGLAEEIAASDRSPSQWWGFQLMLAYPRKEISWEPARKLGDIEALKNGGGQLVVE
MVANASAAKGKQKQTEVDDEDGYETEED
Download sequence
Identical sequences B8PGV5
XP_002474913.1.31404 104341.JGI98475 jgi|Pospl1|98475|fgenesh3_pg.130__10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]