SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|99086|fgenesh3_pg.34__92 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|99086|fgenesh3_pg.34__92
Domain Number 1 Region: 761-830,1043-1266,1296-1367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.17e-39
Family Tandem AAA-ATPase domain 0.087
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|99086|fgenesh3_pg.34__92
Domain Number - Region: 87-112
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00654
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 249-284
Classification Level Classification E-value
Superfamily MTH1187/YkoF-like 0.0746
Family MTH1187-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|99086|fgenesh3_pg.34__92
Sequence length 2161
Sequence
MSSNGRTPRPCRLPAAAPPGSPSTSQNPRSSTPASPSRGGPANLSRGGLTSPFRGGPASP
SRGGPASPSRGGPASPSRGGHVSGVPPRVCNTFWASGSCARAFECTFKHERKPATPAVEA
PVSEEDEVDPDFFSMEGLAMNTGSVREERHSLTPSEAHNYIKSFLGDNHRFENASRVQGF
VRILASVNDRNKSWAFLDMIVNGNAILRVGDILRFEPVSYMIGSGGNTLSFQKGYFPIFE
YFASSLVLKTTLHKNINHLYTVLENNYDTVHAVIEQCVEGMIQAKSWQDPTPSLPSMLQN
SLSGVVVFKTLTTVLHQFFNRFKDAIRAHPTIVTLINYLANWFDTWSADVSATPARFFDP
IVSSPPNVRRLTLAQIKEDVDRLQHIVQRESDATERLRRPAAPVRMSAAQRREVLLAQLA
QTYDPPGEQRHDGPRHDNDKLDISAIRIAPTNNELLCAVAPYLPVFLPDAPHHLTAGSME
RHLDVQFRLLREDLIATMRSSIAAVHSDLAVMWQSRAALRQPTKLEELLTSKGGAYRTSG
FDSVFFQLYTGVEFAPVRAERRDLTVGLMLDTPKHQAARDKDARKRYDYWEHSKRLQSGT
LVALVVVSGTTLRIYLGVTSSFNKDIAESSRAGPDAIQIRVSFFDAEVEFMALRRERISV
DALRFAFLVDNSVMFEAARPFLERLQSIEPTEIPFSRYIAHGGSLEGVELRPPRFATAPN
FRYKLECLAKPGHAGRIQPLNLSTPGGVDAARRQLIASSILDPSQIDAVVNTLNREVSLI
QGPPGTGKSFTAKEILRVLFASGIKPIDHLLTSILDAKITNKMVRLGSRSSDDRIAEFTL
DKLEKIVGGSDMMNRPIKRQYAIMKKLEEDMMTVMASIQLPELGWDDVRKYLSIHHTDLA
ESFETPPFWIVELREKIAKEEEADGEWETAGKKKKSDKKLARTIYGYWRDGQDLQFISPP
SQPPVKGNQKAQPRAALPLVDPTVLEFFSSLGFNSLPPVPTTSRSLKQLLDSDSVWSMSV
GERRRLSEDLEQNIRRLAYMSNLQEYERLRTEYKEACREYNDARDEVSLDDDFSAKQTLS
VVLPQNISPRVLMVEEAGQVLEAHVITSLVQSVNQLICIGDPQQLRPNLASFALSMDSER
GNQLFKFDRSLMERLADNGLPMSQINVQRRMRPTISHFIRQILYPRLEDNDVVLSYPPVH
GMQKDVYFYTHTNKENGSDDSVSKYNSFEVEMIRDLVLYFLKQGVYNGAGQLQKVRAALK
DLKISVSLDERDQEQLVRQGIDEEPEFEEVFVTKHVRLGTVDIFQGQEAKIVIVSLVRNS
GTFETNSASIGFLKSSNRVNVALSRAKHGLYILGNAANLRKNETWSTILNEMDAREQIGH
GFPISCPRHPEQTQVITRPGEIPRLSPAGGCLLPCGYRLSCGHNLPDATKLAIELHAHVA
ILAHGDAGKTVVTASFLCIKSHCHADTSRTEFLGQSTEISSTLRTYSRNGMLPRSQFHSM
QGAVQRRSDMLLQDLQVCMLRLPDGDRWTHVGNNANADRSPLQLLVQGGLPTAMRASQVP
EALLRALCAVHGAVSVDMRPPFVSCCLRLDLCASTLRRAVYEHAPVWTSLSVGRKQDIVD
FIMQRQLKEVDLESSDISERLIRLGCGHMFTVETLDGHCKMSEYYEVDDMGQFVATKAPP
ISYQTPPTCPTCRGPIDALRYGRVTKRATLDILEQNVASTMSRALEEVSPTIEELSSNLE
TMLAAAKQLNSDLETVSVPSATRSAEGRTIDPLSAKHFAVDALQTLHGLQKDEANAWQAI
VKDLVTVYRKTVKVATTRGAHVKAYEAALATLYRLELDAIASDPGRDTDSPEPLAMTAVN
AKIGQPPHKADTRFQIEAYTLSLEVRFMLAQVGASRLEGLPITSDNENVHKHRLLWSSFV
EFILASCLADARKALSMAQRSSASRQAAKCALYVLRSDFEQFRVRIMEERADCLRRAIMK
EGDRNMLAAKVKEKSTYMLNYISKAEEEYIRSRPSQSMADLREERRWFKEHCASKVHRWR
RDCEELEKYMLRDTFYQPMSLQEKEDIVKAFGFSHRGHFYNCENGHTFVITEYRNWGLTI
IYCTSVVAQRRPPDALSVAPRLAVEGMCYMDPTRERQSSNRFRADMARSPEYGPGREMLD
R
Download sequence
Identical sequences A0A1X6MJ50 B8P6P5
XP_002471322.1.31404 jgi|Pospl1|99086|fgenesh3_pg.34__92 104341.JGI99086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]