SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|99270|fgenesh3_pg.169__10 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|99270|fgenesh3_pg.169__10
Domain Number 1 Region: 8-36,210-251,283-338,436-503
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.89e-22
Family DBL homology domain (DH-domain) 0.0052
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|99270|fgenesh3_pg.169__10
Domain Number - Region: 1226-1274
Classification Level Classification E-value
Superfamily UBA-like 0.0128
Family CUE domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|99270|fgenesh3_pg.169__10
Sequence length 1359
Sequence
MERLRTGTRRYHALMELLATEVGYLMDLRALVTVYLEQLSTLTASHPPPSTSALSLPALA
RSLPSSRSSFLLHPLSAPSPSASASLHLETGSDTGHGPPKDEPDREQVKGAKREKSRERS
RVRGTSKVREVTKEKEKSRATDKKKGKEKELEPEGHADMLKEGDHREKENLTLTGQNHDP
HHLRKSSRDEQGNPLPTLQSSNKGKHVRRPLLAEKDVRAVSRNADELLRFHDRFVRELRE
TVGDYGLGRAFVTDLSDEGKSSPNVDDAEPVGLDRIDEAVSIVAEKFINQAASFSLYEAF
CPGHNEATNLIRNVQETYPSEWDAYEQRCSALISYALDFGEGTSEAHGDDHLPGNDSAHP
LSATAVMPPSPPVAEPGRKKRRHSTSSLAMLSSNAHADFMPQVAMTKSDPTERKREHSSS
SSGHGHRTAQAPRLKFLDYLIKPVQRICRYPLLIDQLRTKRQRTLSTGNLPSRTDSTTPN
AEMGLDVAERASEAMRVVVSLVDRASEMQAQIIRSALIASRMIFTHPPVSPASNHGHSAA
GSSNHRTSALGRPQGLTPEFVASLGPCHLTGALDVVHHPSPLYAASNGALRAKYLGTFLY
KGGYLIMVKIPKSGKVYDPRFWFPLSGYELFDSEDDESACQSEKVMWMTALQESLTFPAN
WTNEPASSLQVDDKAHGSFAAEDGPAEWSITPLPTIQSLSELEGQEEQSADGHVRPRALI
ENRPRPSSRLDSMALKQEHMQVSSFAALSRRSSTASVKAFFSPMSLDTITRIARPSPQVR
QHVDHGLHDVFSEKCLAARSQSLLREEDLYQARRRPGTNVSRSNSGLSITGAMGLAARRR
YDSVLVSRRKGSLDGGTEHPTDLEVGGKNLTTLSGKAKSMASKRRKRPLPSVVPAVASNL
AKVESEAELDAPKTQSPTGVDSPFPASHCSSTASSNAGSALPSPVDLIVPLPTYAVHDGT
LRQSDMLGVEESKGKRARSMADNVRYFFTSRPASPSSSSGHHSPTPPPTVPLEPEVDPQT
SFVQWLRKGSLRRRVQSSPEMPQDEGQPASPGRASEENRGSFLVQVSSNKATISLRTDFA
FTRLPVAGPELAAQCESAFEIVFALLELPPSAPASSANAAPLPFLNCPLLADYQHAYDLS
KTLADTLKRADDARAELLEATLRGLDGSDGEGPGALKLLLRSSGIAPGIDYRGRGPSRAT
TGGDAKGKGKGKDKDKAAPLEEDPALDAAVAQVLDILPDQPPEYLRFLLGHSDYPYKGDA
ERLIGALLEGTAPNPDEVEAAMRRAEVVAGVEPSAVREAVVYDEDEFTYTRDRRNAFDDE
AMDIRNVRIGKKTCAYTLTPTNSFLRMLQGRCVNSPAGP
Download sequence
Identical sequences B8PJ84
XP_002475734.1.31404 jgi|Pospl1|99270|fgenesh3_pg.169__10 104341.JGI99270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]