SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|99436|fgenesh3_pg.311__6 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|99436|fgenesh3_pg.311__6
Domain Number 1 Region: 835-910
Classification Level Classification E-value
Superfamily RING/U-box 0.0000759
Family ZZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|99436|fgenesh3_pg.311__6
Sequence length 1079
Sequence
MAESGATTAIKNAVGGFAETLPVLMKALDEIGKIHPVIQGSILAHELSGGLKNVKDEAVT
APDGVTIEARLQGLMKQTAGDIQSCGNVCDAYSKMSLLAKVLKGPLWEGTFASFVSKFSQ
RRDDIEFALSIHIAGKVDGLHEKVDDLAQIVERKTDMIIEFLKNYIPPEHKEVYEQIDRR
GGREAVLKNDDALQSLVSAELETNSSRPSNQATALARNMKHELESQLIDPTFQIQKNNQS
FDRKFEMQQRQILEGVGEIVHRESDRVIESVTSGPHDRILDKDLHQIWKDMGWRGSVKAR
HFVLALRDYEQERREEKLRKEATFQVAPTFDPDAWAFDWITVKRLQAITEALDDDASGFI
TVTEANNFTSSRPADWSLPHWLAYWAIGWQISATIYRDKIHEIFEKMFAIRPHLHEANVL
MIDSYLSEIWAKLLERFQSYIDAEEERLKKNLEAIKYHVDDSTSLALVTGPGRIEKYLFP
LIYLLLKHDYAVFCIGRKEIVNERHNIDASDSQWTINQAVCDRIDDMKASLKHQRLNLAH
HFEHAYSKVYHLMYLAIEDPESPLPLKTIQTFPYKAVTYDDTKEDKDAPTAETVLFYAYD
QSQLSAGAEAMEDIATDEDRKATGHLKNILGHWTGYHYTDTKYPFSVPFTVFFHTLNAES
TQYEALVHAPDSQVEFKVAGDIVTEADGKVTYQFRFIIPVHGMTVDYDGTLNEDGSMLSG
RWGPDGTRPASFFFSKMPEQVLICRPSPMELQTNRIRALWRFALTAVQEQVARRRFTWKF
LAKRRDVRRRYVDLALRTHLGRPLNEAEDEERRKCLGLLSPLDALIAHHLMGLRKRTICI
HKNIACDSCEDDDRDIIDGRIVCLTCGKDGGESVDLCEDCIDTEVDCTKRPDLAAPHLPT
HDLYKLRSLVHHREFRQIASMARDALERARTAFKDAQDVAHEQTEEGGTGETEDHLTKIV
QEDLTCVKCKERVTQPCWYCIVCEDAVFVCMKCDTGGGVSEGKHAKTHGLVRCQEEIVET
EVPAEEKLESMVTNKFAKVDGRLDEMDTRLRQVDERLSRMELLLQAIALKMGAGQDGSS
Download sequence
Identical sequences A0A1X6N5U0 B8PN33
XP_002477087.1.31404 104341.JGI99436 jgi|Pospl1|99436|fgenesh3_pg.311__6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]