SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|99475|fgenesh3_pg.61__31 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|99475|fgenesh3_pg.61__31
Domain Number 1 Region: 110-188
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000287
Family FHA domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|99475|fgenesh3_pg.61__31
Sequence length 365
Sequence
MAPQSGKTVSSSGNDAGLRQVIVVHTVFTYKECCAAGGAMEEGEVYETDHYSATVAYANE
AAADASGNVYSPALEWPHETESELTPPASLTAHSDDAAPTLGSHSHSSPSLRLLVQRSSV
LPKKHSIAVIDGYEEVQLGRDAAHSSSDVPRIRLKEMEVSKIHATIYWDQDRREWAVVDM
GSKHGTFFQAGLSSAAFGDSLVALPSPQAAAPLADDPRGWRLSSPRMASIPRRLNHLDRL
SLGSTTFIVHIHDDQIPCVECSPTGDDEIPLCDARSSQREASRKRKRDLTLSSETAPTKQ
DPKRALATLKRSLLTRHAPYQVVQTSTHNAADVFEPVFDARDRIPRGNANGISLSDTFLH
IYSAA
Download sequence
Identical sequences B8PAE2
XP_002472640.1.31404 104341.JGI99475 jgi|Pospl1|99475|fgenesh3_pg.61__31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]