SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|99485|fgenesh3_pg.61__41 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|99485|fgenesh3_pg.61__41
Domain Number 1 Region: 528-562
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000665
Family Erythroid transcription factor GATA-1 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|99485|fgenesh3_pg.61__41
Domain Number - Region: 83-141
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000907
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|99485|fgenesh3_pg.61__41
Sequence length 771
Sequence
MSFLASPRGYDSLAHSDLALPAIHPSNSRLPMQPLSAFDSVPVHLPPLAPAAPATAPDAP
QPADRSTTALPKLGQTRCYWSLLTPDLHFLYLDPVLAHHLQDQADLLVNKSLLDFVHPDE
QASAKLDLGSVLESRTLHGSVTRVRYSRLSRVRKVLGYQGPAQEWPDADKVAVDDNYMAI
DIVINWASDGLVLCFMHAVVDLSPHDNDEHHKTPWTNWCGTPFMSMDQVQLLHSRLLSAV
PQPLSMSRVFQILLNQPERSLCMSWPPDQPEPGGPISKDFAKLAQDVQISSGSASGTDAK
TSCTRRYKAHQTMNFGVENAKEVESIFIPHATALGSIIFACHKVHPSTRELNPNEAATHS
SHYYPPPGNHPYPDQAHSYSLPPVPAPSQYHNSFPPPPHHSAHYSSGSNWPPHPESPGSP
PHYQQWNTAPSVSSVRSSTYSAPPQQHQWPSQPPSYLDASSAPPPPLNSGPQGSPYPPPG
NGIDDAPPSPGSDTVPPSRVIHRRGSNTRDQYGNGGRSTGNPPVGVARCASCKATHSPEW
RKGPSGKKDLCNACGLRYARSRAKKEGGPPQQSRRRKDRVFDSLSKEPSPSGSPVPAPYS
NVRRGSYYEDGSFPSTSNGSPGELYPPPPRSGHPGFTGTPSPSPPNGGMHYPYPHPPPHH
QNADGRSHYGAHGGQFYSVPPPAPPQQGLPHLAGHEHPPRLEPVTPYSGPNQSSPGVSPT
SPVGGSPMSGNLSIASFERDRTHREHEREGLQPTSVSAETRRSGRSGYMRD
Download sequence
Identical sequences B8PAE7
XP_002472643.1.31404 104341.JGI99485 jgi|Pospl1|99485|fgenesh3_pg.61__41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]