SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|99599|fgenesh3_pg.225__7 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|99599|fgenesh3_pg.225__7
Domain Number 1 Region: 95-141
Classification Level Classification E-value
Superfamily UBA-like 0.00000000128
Family CUE domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|99599|fgenesh3_pg.225__7
Sequence length 426
Sequence
MARELEPLIGLSSLLSFCAALRSAQLRDYHKLLETLYYCNPFLSEVMSNSAEHPPTYAEG
DNGDGHGAVPEFEAHATEGTPDAALPPVSQPQDEHDEAPQVAALRSMFPDFDSTVLQSVL
ESVDYNQDRAIDVLLGMSDPEYVSTAVSPPPEHDLALDEQLARQLALEDEHQAPRARGQA
WPRRGDVPYEARHRTPGQPQSQQQQQQQYVTGSERGDFQELQETLGRMAESGKRTFSSIV
SKAKAKINEYNQQNSQPRPGQTSARPTEQRWDAAPTAQLDRHTAAEAYSQQYYAQNRESN
APPARETRTPPLVTLQDGRSSSNDYRQVTGYDVGPKLDSPLPSASATVRPSSPQNAANRS
SISSARPSGETSQRPLSASGDPIDGAKLGLLPKRAVSLINTSQVPHKSEEEDELEYVENP
FEEGHN
Download sequence
Identical sequences A0A1X6NBA3 B8PLJ2
XP_002476546.1.31404 jgi|Pospl1|99599|fgenesh3_pg.225__7 104341.JGI99599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]