SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|99787|fgenesh3_pg.335__2 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|99787|fgenesh3_pg.335__2
Domain Number 1 Region: 166-196
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000534
Family CCCH zinc finger 0.0064
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|99787|fgenesh3_pg.335__2
Domain Number - Region: 91-115
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000314
Family CCCH zinc finger 0.0037
Further Details:      
 
Domain Number - Region: 138-167
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0269
Family CCCH zinc finger 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|99787|fgenesh3_pg.335__2
Sequence length 316
Sequence
MLKPSSLSIILYAGSNIPWPVNKPSSVGDSKPPRRPVPPITLARNKAGTLVNPNRTYKPK
VSRGRARNMTLNNSHRPYQGRRVSSKRKVNKPCARFTTTGACNRGLTCMYQHDPTKIAIC
WNFLQGNCPNTAETCALSHDPTPERTPLCVHFANNGRCHRANCPFPHVRVGKREGVCRDF
AVLGYCEKGLDCDKQHVRECPDFAEKGECTTKGCKLPHVIRANRNRKAATSAGSKDASAG
QTSPRAAASVSPNSATADASSSHPVTAEEAQLGDEFISLTFHESGSDDDSDEDEDDESDD
DEEDANEEVTETHDSE
Download sequence
Identical sequences B8PN83
104341.JGI99787 jgi|Pospl1|99787|fgenesh3_pg.335__2 XP_002477139.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]