SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|99806|fgenesh3_pg.91__12 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|99806|fgenesh3_pg.91__12
Domain Number 1 Region: 217-247,415-462,494-549,647-714
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.78e-22
Family DBL homology domain (DH-domain) 0.0052
Further Details:      
 
Domain Number 2 Region: 808-886
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000118
Family Pleckstrin-homology domain (PH domain) 0.041
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|99806|fgenesh3_pg.91__12
Domain Number - Region: 1717-1765
Classification Level Classification E-value
Superfamily UBA-like 0.0209
Family CUE domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|99806|fgenesh3_pg.91__12
Sequence length 2059
Sequence
MDLDPAHSTAQAHRNACYAIEFFKQTRDKKQEQGRPAPSMPSSSSLASTSTATSIATVRG
RHHSSHAGDAFRMTLAPRRRLSLPTFSKAFRDDPVPARTSTASSSPTRQPKRARERTLSP
LRASMVAKNGSARKLFTLDGDTEGSDAEEDPERDQDRERAAARERIRQEEIQAIAAAAEA
QRQADAELQHEEEEERARDEANRMAMVSEAEMERLRTGTRRYHALMELLATEVGYLMDLR
ALVTVYLEQLSTLTASHPPPSTSALSLPALARSLPSSRSSFLLHPLSAPSPSASASLHLE
TGSDTGHGPPKDEPDREQVKGAKREKSRERSRVRGTSKVREVTKEKEKSRATDKKKGKEK
ELEPEGHADMLKEGDHREKENLTLTGQNHDPHHFRKSSRDEQGNPLPTSQSSNKGKHVRR
PLLAEKDVRAVSRNADELLRFHDRFVRELRETVGDYGLSRAFVTDLSDEGKSSPNVDDAE
PVGLDRIDEAVSIVAEKFISQAASFSIYEAFCPGHNEATNLIRNVQETYPSEWDAYEQRC
SALISYTLDFGEGTSEAHGDDHLPGDNVAHPLSAATVMPPSPPVAEPGRKKRRHSTSSLA
MLSSNAHADFMPQVAMTKSDPTERKREHSSSSSGHGHRTAQAPRLKFLDYLIKPVQRICR
YPLLIDQLRTKRQRTLSTGNLPSRTDSTTPNAEMGLDVAERASEAMRVVVSLVDRASEMQ
AQIIRSALIASRMIFTHPPVSPASNHGHSAAGSSNHRTSALSRPQGLTPEFVASLGPCHL
TGALDVVHHPSPLYAASNGALRAKYLGAFLYKGGYLIMVKIPKSGKVYDPRFWFPLSGYE
LFDSEDDESSLPFSFHLVGSGHHLQFAAACQSEKVMWMTALQESLTFPANWTNEPASSLQ
VDDKAHGSFAAEDGPAEWSTTPLPTIQSLSELEGQEEQSADGHVRPRALIENRPRPSSRL
DSMAVKQEHMQVSSFAALSRRSSTASVKAFFSPMSLDTITRIARPSPQVRQHVDHGLHDV
FSEKCLAARSQSLLREEDLYQARRRPGTNVSRSNSGLSITGAMGLAARRRYDSVLVSRRK
GSLDGGTEHPTDLEVGGKNLTTLSGKAKSMASKRRKRPLPSVVPAVASNLAKVESEAELD
APKTQSPTGVDSPFPASHCSSTASSNAGSALPSPVDLIVPLPTYAVHDGTLRQSDMLGVE
ESKGKRARSMADNVRYFFTSRPASPSSSSGHHSPTPPPTVPLEPEVDPQTSFVQWLRKGS
LRRRVQSSPEMPQDEGQPASPGRASEENRGSFLVQVSSNKATISLRTDFAFTRFVPLPAY
PSSRVRASLSPSQLVSLHQTVTSALAQALALPPAQCDSSTNRTFVSSYAKDAAHTALQHL
IWNDEQKPSKVFADLSQIERTIRQRAFYLAERLAASASLDLQTLFDLCVAYAPTNATRLR
NLLSSAFSHNASTLFKAVQGEAVPAFTAMLSTPSQGLYGLRKTAHILLCFLRPAPADLVR
PFARDKSFTLALARAYDHGLANFAQSYGGLRLPSNGDIQASRLDEWERLFLETKVALLDS
FHILIGTLLADLAAVPVAGPELAAQCESAFEIVFALLELPPSAPASSANAAPLPFLNCPL
LADYQHAYDLSKTLADTLKRADDARAELLEATLRGLDGSDGEGPGALKLLLRSSGIAPGI
DYRGRGPSRATTGGDAKGKGKGKDKDKATPLEEDPALDAAVAQVLDILPDQPPEYLRFLL
GHSDYPYKGDAERLIGALLEGTAPNPDEVEAAMRRAEVVAGVEPSAVREAVVYDEDEFTY
TRDRRNAFDDEAMDIRNVRIGKKTDDVSAVLQDREFMEQMKADILRRAEAISDEEDEDRP
HNASRYVAFEEELDDDDGGAVKVRDGDESELDGPDMDEDVEETEDTRMKPETILELAYLQ
DPKQFDRDGQTRRSKARADLKAQTGWTDEQIEGWKIMLERNPNKDKVLAKHEFSGNKPLQ
PGPSSGPSHLGGTNRGRGRGHGRGGRGRGGGRGGSGGGGGGEGSNAGDRAWKDKNKASRA
NHNRKRGHDKKMARAGGPS
Download sequence
Identical sequences B8PDF3
104341.JGI99806 XP_002473718.1.31404 jgi|Pospl1|99806|fgenesh3_pg.91__12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]