SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|99918|fgenesh3_pg.217__1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|99918|fgenesh3_pg.217__1
Domain Number - Region: 1-23
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0418
Family Erythroid transcription factor GATA-1 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|99918|fgenesh3_pg.217__1
Sequence length 162
Sequence
LCNKCGLFERTHSRPRPEQFPHKRGPLVTATFKSARTPPPGSSGGVQRLPPIAAHHMHAM
PPHHSNHPSIAPLMPRADGSPHQHPAQIPPPPPGQGQGQQGYPSASTVPEIRSLLNTPAG
HAQESADGTRPPSPEQQQQQVQVQAAPESPRGERRDAYRAAN
Download sequence
Identical sequences B8PL96
XP_002476451.1.31404 jgi|Pospl1|99918|fgenesh3_pg.217__1 104341.JGI99918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]