SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|105051|fgenesh3_pg.6__139 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|105051|fgenesh3_pg.6__139
Domain Number 1 Region: 391-489
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000285
Family Thioltransferase 0.042
Further Details:      
 
Domain Number 2 Region: 90-185
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000978
Family N-acetyl transferase, NAT 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|105051|fgenesh3_pg.6__139
Sequence length 502
Sequence
MTAAITDDPMHLYLDDAPDAGMSHLRQILRRVKMGTRMAIEIYSGRSFTVDRGAANVQIV
HLSTRKIQRGEELNKKMEDAIKEAFGNRIEHMYAVESLATDPKMQGRGYGTALVATVTDK
ASIAHGRCVCSYIDTVIWLTSGKKADAQWVDTWLVSSNVANTGFYEHCGFQTVSTFTLGD
GNPTWTRPPVVVTVMIREFRPQTRREKAFLISVPHPMAHRRTQSQRYPTMNSPLALESPP
LTPTLAVFGSLTTRNPKSYWYRTTFLALFALVVLSVYVLLVAQPSLSSIPMFEPDGARHP
PSRISSEAYRLAALRHKHAAGVASVGSAGSAERPQIELDSAQELAAVSSFIASLPQNVIP
SFVDPSRPIDPQLVLDFDTRSVQAVEEVQTVVNEVWARNPVMLYSKFYSPVSREIKQMLS
EMYLSPSPTIIEVDQRTDESVLAPLLFRLTSKAELPILLIGGRPVQGSLEELRYLKKKGE
LQRMISAAGAEIYGAKKKQRKF
Download sequence
Identical sequences B8P122
XP_002469338.1.31404 jgi|Pospl1|105051|fgenesh3_pg.6__139 104341.JGI105051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]