SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|105134|fgenesh3_pg.95__42 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|105134|fgenesh3_pg.95__42
Domain Number 1 Region: 17-125
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-29
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0018
Further Details:      
 
Domain Number 2 Region: 159-250
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000536
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|105134|fgenesh3_pg.95__42
Sequence length 341
Sequence
MPAQSTLSSDDKSKVKAAVPNNSNKIHTAALARIYYAHPNPNEWSYAGLQGALAFIHDKS
KGALYLRMVDLAGTRGVIWQHELYEGLEYFQDRPFFHSFPGDECMIGIVFAEESEAKTFY
KKVTTTKVGTEKPKSSNKKKASKGGKIDKSMISGPTSGSFQHVAHMGYDPVKGFTSSNVD
PSWSAFLSQLEGHGLSREVLEQNMDFIKDFVRDAQKSAPAPPAAKKKPPPPPAPRGMPPP
PPPPPPAGGSPGPSAGLPAPAPGRDALLASIQSAGVHMLRKTDPNATPARPTSPPAEESA
SSSGGGGGGGDLTAALAAALLERNKKLGDSDEEEDDDDDWD
Download sequence
Identical sequences A0A1X6N0D5 B8PDU4
104341.JGI105134 XP_002473857.1.31404 jgi|Pospl1|105134|fgenesh3_pg.95__42

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]