SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|106782|fgenesh3_pg.1151__1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|106782|fgenesh3_pg.1151__1
Domain Number 1 Region: 17-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000137
Family Glutathione S-transferase (GST), N-terminal domain 0.0097
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|106782|fgenesh3_pg.1151__1
Domain Number - Region: 162-243
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000156
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|106782|fgenesh3_pg.1151__1
Sequence length 256
Sequence
MPSHLITLYDIQCKLDSTAWSPHTWRTRIILNYKKLPYQTTWMPLPDVQTVLPAVGVLPT
RTAVPHYTVPAIVDELEGSPAVVMSDSGLIADYLERTYPEPSIYHGAKALQMEHVGAVSQ
HVLSRMGFMVFPNTPRLLEGREREYYLNTRKGIFGVELDDMFPEERQEEMWANLKEGFAA
LGAYIDGIEHSEQWFFSKTSEPGYADFVLGATMIWFKLSGPEKGWERISEWDGGKWARFF
RNLEPYTASSVIDSSS
Download sequence
Identical sequences B8PPL1
XP_002477616.1.31404 jgi|Pospl1|106782|fgenesh3_pg.1151__1 104341.JGI106782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]