SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|108287|estExt_fgenesh3_pm.C_520010 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|108287|estExt_fgenesh3_pm.C_520010
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.54e-33
Family Glutathione peroxidase-like 0.0000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|108287|estExt_fgenesh3_pm.C_520010
Sequence length 171
Sequence
MAPTVKVGDAVPEGTFAYIAYAPELDDHTACGIPTKLSTSEWKGKKVVLFSVPGAFTPTC
HVNHLPPYLEKYEEFKKKGVDVVAVVAANDAFVMSGWARVFGLKDKIVALSDSDAKWSKS
LGLDKDLSAIGFGTRTDRYALVLDDLKIKYIGLEPGADVTVSGADAVLAAL
Download sequence
Identical sequences A0A1X6N124
jgi|Pospl1|108287|estExt_fgenesh3_pm.C_520010 104341.JGI108287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]