SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|108766|estExt_Genewise1Plus.C_10263 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|108766|estExt_Genewise1Plus.C_10263
Domain Number 1 Region: 844-924
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-24
Family U-box 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|108766|estExt_Genewise1Plus.C_10263
Sequence length 944
Sequence
MSDDLEYLSVIASLPPQQTSFQYLVGCWKRLNATRSAFLRKGYPPVENQRGQDLLDKLRD
LVISYAGLSLQEPEMFPQPSGRDLGPSELVAPLLSLSSLSAPLLSTSASSPNTLSPFEVE
PFLQDLAKRFEPENEIDGVLGPVVTQLCCHPSLFRPEGLAGGDASWRSVIGGLEALVSIK
SIAMMITRLENWIPPNATAPDFERVSLLGPLLRLGVFEREWPAIANTYYSKPKERSQGDI
ESSTASLRGTLKSLQSSMFQVFNTLVRASPETREAVLQYFARVIALNHRRAGSHVEPDTV
ASDCFMANLQTILFRFCEPFMDANYTKIDRIDPAYYAHSSRINITEETRINATSEEAEQW
RERNASPGDAPNFISDIFYLSMAMNHYGYQKTISTFEDLARQYDEINRHLEMLEGDGSWR
GTMFQARTETAIKAVKVELDKVLTSQLAFSVQLVDPEIVFRSVSFVNFVSTWLIRLVDPK
RRHPNPPVELPLPKEVPESFKVLPEYLIEDVIDYQLYVVRQSPESLELSGKNEILVWTLT
FLTSTWYIKNPFLKAKLVEVLFYASLNWGGHRAIMTSTLNSHPIALKYLVPALTHFYIEV
EQTGASSQFYDKFNSRRNIAYLFRAIWDNAVHREALKNETRNNMEKFVRFVNLMINDVTY
LMDESLSELTKIHEIQTEMEDAATFNSKPVQYRREREGALRSLERHASGYVQLGNSTVGM
LKAFTGETKEPFMVPEIVDRLAAMLDYNLDALAGPKCQDLKVKNPEKYKFNPRQLLSDLL
RVYLNLSDQGEFARAIAGDGRSYRKELFERAAGIAKKRLLLNDTEIEKLLMFVVKVEETK
ATLEAEDDLGEIPDEFLDPLMFTLMRDPVTLPSSRAVVDRSTIKSHLLSDSKDPFNRMPL
TLDDVTPDVELKEKIDAFLAERQNKNTALDKPAEDVVKMDVSAD
Download sequence
Identical sequences jgi|Pospl1|108766|estExt_Genewise1Plus.C_10263 104341.JGI108766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]