SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|110634|estExt_Genewise1Plus.C_220197 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|110634|estExt_Genewise1Plus.C_220197
Domain Number 1 Region: 36-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000926
Family Thioltransferase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|110634|estExt_Genewise1Plus.C_220197
Sequence length 314
Sequence
MLLPLLALFALPLCLAASTEANHAKLVQLAAANDGVIRLDQSTYRLLTSPRRNWSASVQF
TAMDKRRRCTPCREFGPSFNAVAKAWSKVSSAERDSHFFATLDFDDAMPVFQEMNLQSAP
VVQVYTATEGPRQSASGRTAISLDFSQGFEAAPLAEQLSHYTPVPIPYKPPFDWSRAATF
VFMALAFVAALRFMAPILRSRWTWAVIVVLTSLVMTSGYMFVRIRGMPHSGPNGQWIAPG
YQNMFGQEVQVVSMIYGTLAGGFLMLTLIVPNNLSPQRQRMQVYLWAGVIFIMYSVLVSL
FREKNRNYPFKLLF
Download sequence
Identical sequences A0A1X6N8W8
104341.JGI110634 jgi|Pospl1|110634|estExt_Genewise1Plus.C_220197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]