SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|111293|estExt_Genewise1Plus.C_300073 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|111293|estExt_Genewise1Plus.C_300073
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.29e-34
Family Thioltransferase 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|111293|estExt_Genewise1Plus.C_300073
Sequence length 105
Sequence
MPVTTVTSLDQFHKIINGEKVAIFDFWATWCGPCKVISPIFEKLSDQFPDLEFYKIDVDE
QQEISQEVGIRAMPTFIAFKNGQKVKDLVGANPGALQELIKAVSA
Download sequence
Identical sequences 104341.JGI111293 jgi|Pospl1|111293|estExt_Genewise1Plus.C_300073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]