SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|113864|estExt_Genewise1Plus.C_210023 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|113864|estExt_Genewise1Plus.C_210023
Domain Number 1 Region: 5-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.84e-67
Family Glutathione peroxidase-like 0.000000553
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|113864|estExt_Genewise1Plus.C_210023
Sequence length 210
Sequence
MVATVQKPAPGFKAPAVVDGLFQDISLSDYLGQWVVLFFYPLDFTFVCPTEILAFNDALP
QFKQLNTTVLSVSTDSHFSHFAWATQDRKQGGLGPDLKLPMIADKSMSISRDYGVLIEEE
GIALRGLFLIDPKGTLRQITINDLPVGRSVDETIRLVKAFQFTDEHGEVCPANWTEGSQT
IKTDPHGKLEYFSTAGGANGEQSRKRPRID
Download sequence
Identical sequences 104341.JGI113864 jgi|Pospl1|113864|estExt_Genewise1Plus.C_210023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]