SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|114631|estExt_Genewise1Plus.C_1960027 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|114631|estExt_Genewise1Plus.C_1960027
Domain Number 1 Region: 325-379
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000899
Family RING finger domain, C3HC4 0.052
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|114631|estExt_Genewise1Plus.C_1960027
Domain Number - Region: 28-161
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0484
Family Outer membrane efflux proteins (OEP) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|114631|estExt_Genewise1Plus.C_1960027
Sequence length 387
Sequence
MDGPLKELAKLEKLASNASAKGKAPNINDSLDALLHSLREVKDRLQVGSATEDTLSILAR
TVEGKKKEVDERQKEVYNTLNRLGKTLDKKFSSPLPSYPPLFASPEAVSALERTVALHFL
RTGQFNTAEAFIEEVGMDVDAETRGRFVDLHHTLTALRQRDIRAALVWTEQNRDFLRARS
SSLEFFLHRSQYINLLLATHPPDVASALSYAKAAFPPFSSTHEQEIRRLMTCVLYLPLAR
LQASPYADLASPSLHLDLEPMFAKEYCASLGMSRQVPLRVVGDIGGGGALARIEKGRRVM
RERKSEWSRTDELPIEIPLPPQNRYHSIFACPVSKEQSTDQNPPMMMTCGHVITKDSLHK
LSKNSQRVKCPYCPVESQLAAALRVYF
Download sequence
Identical sequences A0A1X6NA10
jgi|Pospl1|114631|estExt_Genewise1Plus.C_1960027 104341.JGI114631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]