SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|114833|estExt_Genewise1Plus.C_770038 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|114833|estExt_Genewise1Plus.C_770038
Domain Number 1 Region: 204-393
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.83e-31
Family WD40-repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 2-54
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000015
Family U-box 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|114833|estExt_Genewise1Plus.C_770038
Sequence length 406
Sequence
MFFCSISGEPPQDPVISQKSGHVYERRLILKYITENSTDPITGEKLEESDLITVKANPKT
AAPRPTSATSIPALLHTLQNEWDALMLETFSLKQQYNSVRQELSYALYAQDAATRVVARL
MRERDAAREALASVSATMGIAPAPSGDDVEMSEPGQETVALPEEAAKQIEETRETLSSKR
RKRKPPPGYVNPADVKTFTAKHTIPSLHSTSPSGITALAVSRSEPSQFLTGGNDKVVQLY
DRSTDKVLASLKGHTKKVTAVAFRDAFSESEPTLLLSASADKIAKVWAHDSASGEYIPRA
TIRTHRGELSGLAVHPTKTLVALASADRTYSLHDLTTGNLVYRSPVGDEPFASLGVHPDG
TLVAVGTPTSTIKVFDIRSGAIAASLSPPESITNLPLLVNLTYPLN
Download sequence
Identical sequences 104341.JGI114833 jgi|Pospl1|114833|estExt_Genewise1Plus.C_770038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]