SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|115089|estExt_Genewise1Plus.C_790057 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|115089|estExt_Genewise1Plus.C_790057
Domain Number 1 Region: 143-240
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.81e-32
Family Thioltransferase 0.00029
Further Details:      
 
Domain Number 2 Region: 6-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-21
Family Thioltransferase 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|115089|estExt_Genewise1Plus.C_790057
Sequence length 242
Sequence
MTVAAPENVREVTSPEHFQELLSADLERVSLINFWAPWAEPCKQMNDVVLELGRKYPQLL
VLQVEAETQSDISESFEIESVPAFIILRGHTLLGRISGADAPALTDAVAKHTKPPAAVKP
LAKTDRAPAAAEALSEKEETQEELNERLRALMNKDKVVLFMKGEPDAPRCGFSRRIVGLL
QDQGVPFAHFDILSDEKVRAGMKTLNNWPTFPQLIVNGEFVGGLDIVQEMVENGELKEMV
AA
Download sequence
Identical sequences A0A1X6MRW0
104341.JGI115089 jgi|Pospl1|115089|estExt_Genewise1Plus.C_790057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]