SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|115689|estExt_Genewise1Plus.C_1010064 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|115689|estExt_Genewise1Plus.C_1010064
Domain Number 1 Region: 20-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.44e-33
Family PDI-like 0.011
Further Details:      
 
Domain Number 2 Region: 142-252
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.25e-32
Family PDI-like 0.0096
Further Details:      
 
Domain Number 3 Region: 266-358
Classification Level Classification E-value
Superfamily ERP29 C domain-like 1.18e-20
Family ERP29 C domain-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|115689|estExt_Genewise1Plus.C_1010064
Sequence length 371
Sequence
MKFALSFLAAALSLGSALASNVIELTPDNFDAVIGQGKPALVEFFAPWCGHCKNLAPIYE
QLADAYAHAKDKVVIAKVDADGVGRPLGSQYGVTGFPTLKWFNAAGGEPEKYEGGRDLDA
LANFVTSKSGVKSLIKPPPPPAYKILDYSNFDDVVVNSDNNVLVAFTAPWCGHCKNLKPT
WAEIAKDFASESQCIVANVDADAAPNKPLAEKYGVQSYPTLKFFSKGRKDEPEDYDGPRS
EEAFVEFLNEKCGTQRAPGGGLTELAGRLPEFDTLASQFVAAAGEARDAIYKDASALAAS
VGPTASHYVRVMEKVVNGSEEYLEKETKRLTSILQKRTLAPAKLDELKVKANILGAFKKV
EEVVARATAEL
Download sequence
Identical sequences 104341.JGI115689 jgi|Pospl1|115689|estExt_Genewise1Plus.C_1010064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]