SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|116492|estExt_Genewise1Plus.C_750087 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|116492|estExt_Genewise1Plus.C_750087
Domain Number 1 Region: 9-190,285-374
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.8e-50
Family FAD-linked reductases, N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 429-587
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.14e-18
Family Glutathione peroxidase-like 0.0026
Further Details:      
 
Domain Number 3 Region: 193-291
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.49e-18
Family PHBH-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|116492|estExt_Genewise1Plus.C_750087
Sequence length 679
Sequence
MSATAHPRKVDVLLVGGGPTALITAYLLLKAGLSVNVIERYNKAEQAMYGRACMLYSRSV
ELLDQIGIFDRIADIGYFVRDSTTFKNGIEIPARGWSFVREAAKGKTYFDFSFSIRQKHI
EDTLRAAIAEMDPTAVHAPATLTALAVDPSNDHPVQATVEENGSVSVVQCKYVIGADGGR
STVRSLSQIAFPGTESKHRWVRLDAVVRSDIPIGRKHSAAIESHEYGNVLWTPTDNGRTR
IGFVLRDEVYDTLGGNITAEVIESEARKAVQPFSLEFLQLDWWTVYKIGQRVADTFKQGP
VFLAGDAAHTHSSGAAQGMNTGIHDATNLAWKLAGVLRGWLSEAVLDTYDAERRTSAQHL
IQLDRDVAALISGKIPDHFNAPPDADVNVYLDRVFTENASFTIGLGISYASNVLNKTSSI
GVPSPIDALIGHRAPDVILYRPGPAIPTRLQELTRYVGRFWILIFAGALESSPTNVCLSA
SCAEKYANLTRYIASDVSFACTLAPMFSFLTIVHGSGALQSAEALGTEPLGKTAYDPTGE
AYVKYSVEPSEGAIVVVRPDGIVGFRASMDGGSDVTDYFSAFLRPAKAGPGNAQSATTWV
LGEISLEDQENDVMISTQGELNDSHASFAALTGVIVVSRSWEVSDVVFVILLVAFIDRDT
CSSTCVIMPDCSLHAKRVG
Download sequence
Identical sequences A0A1X6NC00
jgi|Pospl1|116492|estExt_Genewise1Plus.C_750087 104341.JGI116492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]