SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|119030|estExt_Genewise1.C_140078 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|119030|estExt_Genewise1.C_140078
Domain Number 1 Region: 20-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.22e-34
Family PDI-like 0.0011
Further Details:      
 
Domain Number 2 Region: 324-471
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.58e-28
Family PDI-like 0.00096
Further Details:      
 
Domain Number 3 Region: 232-361
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.85e-23
Family PDI-like 0.00046
Further Details:      
 
Domain Number 4 Region: 133-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.61e-18
Family PDI-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|119030|estExt_Genewise1.C_140078
Sequence length 501
Sequence
MRFSHLFSSATALALATVVVADGASDVLSLTADSFDSVVNPEPLILVEFFAPWCGHCKAL
APHYEEAATALKEKKVKLAKVDCVDQADLCQANGIQGYPTLRVYRNGDHTDYTGPRKADG
IIAYMVKQSLPAVSDVTPDNFNEFIQADKIVAVAYLPSSADAPGPEFTATANKHRDDYLF
GSTTNSALAEAEGVSPPAIVLYRAFDEPKTEYPYPIGSAKVKDIEKWIKELSIPVIDEVN
TENYQMYAQSGKPLAYLFLDPTDSLHDEYIASLRSVATKYKNNVNFVWIDAIKFGDHAKA
LNLNEPKWPSFVIQDLQKQLKFPYDQSKEFQAEEIEKMVAEYAEGKLQPQLKSQPIPATQ
DEPVFNLVGKQFDEVVFDDEKDVFVEFYASWCGHCKRLKPTWDSLGSHFANVKDRITIAK
MEAQENDLPADVPFRISGFPTLKFKQAGSRDFIDYNGDRSLESLVAFVQETAKNPLDANV
PFKNDSQQQHFEAVPEHHDEL
Download sequence
Identical sequences jgi|Pospl1|119030|estExt_Genewise1.C_140078 104341.JGI119030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]