SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126292|estExt_fgenesh3_pg.C_480059 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126292|estExt_fgenesh3_pg.C_480059
Domain Number 1 Region: 7-69
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000155
Family Glutathione S-transferase (GST), N-terminal domain 0.0056
Further Details:      
 
Domain Number 2 Region: 230-282
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000849
Family Glutathione S-transferase (GST), C-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|126292|estExt_fgenesh3_pg.C_480059
Domain Number - Region: 332-354
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0412
Family Glutathione S-transferase (GST), C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126292|estExt_fgenesh3_pg.C_480059
Sequence length 358
Sequence
MASPDLPKAALYYFPKSIWSTIPLLVLEEKGYAPDEIDLKVVDLHKGEQYTPSYLRLNPN
GTVPTLVVPLHKTLSLEIESRYKAIQDSKARSIAEFLDKSRSTQSRTHTTSSAPSPSLSP
ATIAFSAVSEKVIALIRSDAANPNALTILNGHDEESLRVVTEARLWVLTARQQALERLLT
DNESASISVSEKTRRFWETKKNSVAEYLPVLQDAEKPTDQLDGHARQVRENYWKDSKAAW
FALRQALLQLNQEIIGPYVLGDQLSLADLHLAAWLARLVKLSGGTISDDGNTAIGRIEAH
TGPAFSLPKDLSVAEARRRAGLPIPDAESNERQNRLAAFWDAVKERPSFKKVYAEGLH
Download sequence
Identical sequences jgi|Pospl1|126292|estExt_fgenesh3_pg.C_480059 104341.JGI126292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]