SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126398|estExt_fgenesh3_pg.C_920033 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126398|estExt_fgenesh3_pg.C_920033
Domain Number 1 Region: 8-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.42e-28
Family Phosducin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126398|estExt_fgenesh3_pg.C_920033
Sequence length 266
Sequence
MAVNADEDTEFNDALRKHGILPPREPPPSPSQPPSPTLEEALGDLTPAELRELGEDANDS
ETERVVENHRRQRVAELRKQEKARFGRVYPIGRDEYTREVTEASKVTEEGKPESHGTGVV
CFLYKDGIPRSDRAFEHIRILAQRHPDTKFVSMVGDKCIQNLPDTRIPMFIVYRNGEVLN
QVVAWGADRERRIEELEAVLILAGAIVPQQRPPPKERGSRSDSSEDEDDTDDEPSSRMRS
AATRTNHKSAKNIRQAKEDSDSDFDL
Download sequence
Identical sequences 104341.JGI126398 jgi|Pospl1|126398|estExt_fgenesh3_pg.C_920033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]