SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|126528|estExt_fgenesh3_pg.C_990044 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|126528|estExt_fgenesh3_pg.C_990044
Domain Number 1 Region: 9-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000382
Family Thioltransferase 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|126528|estExt_fgenesh3_pg.C_990044
Domain Number - Region: 122-146
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000607
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|126528|estExt_fgenesh3_pg.C_990044
Sequence length 280
Sequence
MAARVGRIARLTLFSGPQCSLCDIAKAELAKVRQQRSFELETINIQDAGQERWKRKYVYW
IPALHLEGREIAKGRWDAHTVNQAIDTWEKDPWTRDGQGSNIFYDWCRDTALGTGMQEPD
PDYATRCFNCGSYNHVYSSCADPLNPALIKLSRQLHRFHKDTVVYRHQRVHEVVEWKRQR
LAWLEEFEPGQIKGHLLRDALGLQEHDTGEHVEWLRNMAHWGYPKGWVGGSDPRERVRWL
IYDDGDKAEDEPEAFIIVGEDIEEQLTLSVVLLRRRRIHL
Download sequence
Identical sequences jgi|Pospl1|126528|estExt_fgenesh3_pg.C_990044 104341.JGI126528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]