SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127483|estExt_fgenesh3_pg.C_960047 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|127483|estExt_fgenesh3_pg.C_960047
Domain Number 1 Region: 57-119
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000726
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 2 Region: 18-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000275
Family CCCH zinc finger 0.0037
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|127483|estExt_fgenesh3_pg.C_960047
Domain Number - Region: 148-176
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0222
Family CCCH zinc finger 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127483|estExt_fgenesh3_pg.C_960047
Sequence length 636
Sequence
MSLLFLHGESEKLTPYDKSKTCHFYAAGFCRRGDKCWFQHVASDASTSQIQTAPAAEEEE
LCCIXYEKPVTYGLLIGCSHMFCIHCIREWRSSNKRSVEVVFSGVTKQCPLCRAASRFVI
PSSQYFPEGHPRKAETINRYKASMARVPCRHFQNSPANRRFCPFGKDCFYQHLKDDGTPY
IFQHGADHNMRIYRRRLERANGRGPHGLIGDLFPDFPDLGATIDALRASLPGLMEGLGLP
MVPMDDADWDIEPEEDFEDRPLVETMEMLAEEVGGRTFYRFGTAPTIPIADNGPAFAPRT
DVQNPGLQPDQQLNTRGLDALVPSTAATPSTVMERAPANRSVSDSPSRFSTVVTREDQAS
TSLSISSLDDLRQLPDLAANPPQVPSLFIPDAVGSLVPQARTASTADTVPPEARQSVIPR
DSAIQASATARPSNSQASQEEAPSEPISAPPAEVVHDTDPPFLTDGRGRVVWSSTTAGRH
RGDRESRRAGRAAAAAAASASAPAPVQAQQKMRREASDSDVAIARAESGSGEDSGGRERQ
GSRPRQSARVLSSPEGTQQISDGSLEVLDGIRSDERRFLLPASDAQAIEGPIASGSTEEP
EAPGTDEDEQQLIEEVARRNEGRSFFGRIFGAVLFF
Download sequence
Identical sequences 104341.JGI127483 jgi|Pospl1|127483|estExt_fgenesh3_pg.C_960047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]