SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127527|estExt_fgenesh3_pg.C_1370018 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|127527|estExt_fgenesh3_pg.C_1370018
Domain Number 1 Region: 576-966
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.2e-134
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.000000000507
Further Details:      
 
Domain Number 2 Region: 372-561
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.03e-61
Family Inosicase 0.00000218
Further Details:      
 
Domain Number 3 Region: 43-147
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.84e-30
Family Thioltransferase 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127527|estExt_fgenesh3_pg.C_1370018
Sequence length 966
Sequence
MATRMFRSAFRSTANPLLRSSVPSQLFASPTLSLARRYLSQEARSKIQEAVSTTPVVLFM
KGTPEAPGCGFSRAAAQILGLQGVPPEKLKTYNVLEDSELRSGIKEFSDWPTIPQLYVNG
EFVGGCDIMLSMHQSGELEELLDKKGVLPPVAEETQQPTCIVPGECDLLLWCILHNTFGI
QHSSSDLLSLRPHEILDCFEFTLFHALFKPGKVVSYEMSAGLRAAGKWTMAMPVGEIVDA
VRTNATENGVVGCGARSLASLRANMQARSAWLNCFRYTSLKFMKLVFYVWLGILSQHIYH
ENYDLDSAYSSKKYGLAWFYYYIILHASLCDRLWNGDREIDDRGKSKWAPKLERKVFILV
LDLSSAMAAPIALLSVYDKTNLLDLATGLHAAGVRLLGSGGTAKKIREAGIAIEDVSDIT
KAPEMLGGRVKTLHPAVHGGILARSIPSDEADLKAQSISKISIVVCNLYPFTSTIAQPGC
TLADAVEEIDIGGVTLLRAAAKNHTRVSVLSDPTDYAEFLEAWRAGQGDVGQAIRSKLAL
KAFEMTATYDDAISGYFREQYASAELPAERLAGPVQRLALRYGANPHQKPAQAYVTDGEL
PFKALCGSPGYINLLDALNSYALVKELQAALGLPAAASFKHVSPAGAAVGVELDETEKKV
YGVDDLKEPLTPLASAYARARGADRMSSFGDFIALSAPCDLATARIISREVSDGIIAPGY
SQEALDVLSKKKGGKYCVLQIDPSYVPAEIETRQVYGIHMQQRRNDAKIDAKLFENIVTK
NKALPNQALTDLIVATLALKYTQSNSVAYAYRGAIIGIGAGQQSRIHCTRLAGTKADLWW
LRHHPRVLALPFKKGVKRAEKANAIDLFVGGEVLEGGERAQWEGLFEAVPAPLSAEDRAT
HAKLLDGVACSSDAFFPFPDNVHRARRSGVRYLAAPSGSVMDAECIKAADEHDMVFAHTS
LRLFHH
Download sequence
Identical sequences jgi|Pospl1|127527|estExt_fgenesh3_pg.C_1370018 104341.JGI127527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]