SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|127632|estExt_fgenesh3_pg.C_50030 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|127632|estExt_fgenesh3_pg.C_50030
Domain Number 1 Region: 248-333
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000032
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|127632|estExt_fgenesh3_pg.C_50030
Sequence length 528
Sequence
MDLYPNAIGSPTALSGGVPLQNVGQDVGTQPRLNDARATVDSAACEPIVQSISRNVQSVA
IDPVLNDDEDDDLPPLASDSESELGEPEDVDSHHSDDSMPSLQTVSDSSDSDYNPAASDL
DEPEDEHAEESRENVTAAASNAPANIAVPEPLDSDEAYDDDEEEDSEVDDSDDYDEWQDD
VYEETMAMQEAQEMLAGGTHIAEMLEILGRLRPAVDNDPLRAETLLEGLEEVSHDLVKRY
EKLRGGLDDDNEGCAICRDEFVDDVAADPLEPAKLSDAVLTSVLFEALPFHPPPCTILAF
PCLGRHLFHSNCLAPWLARKTTCPSCRFDIDPDSLTLRTVTASSQLIDEQFDTRKLWEPP
RVSSFATWIEQAELAREREAKGIPIVKAVPVDREVDDCPADDEREDMFHPPLAVPNQHNA
DAIRHSGDVSSGRQPPSTPSAPTTDAATFPGFLPSIRQGRMEHIMAMLGVETPSSRTAMD
LHDSMLEDVMRALRMGRASVAGMRPPQARPQEDPRTDDLLSQAPVDID
Download sequence
Identical sequences jgi|Pospl1|127632|estExt_fgenesh3_pg.C_50030 104341.JGI127632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]