SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|128161|estExt_fgenesh3_pg.C_70044 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|128161|estExt_fgenesh3_pg.C_70044
Domain Number 1 Region: 61-241,331-420
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.83e-56
Family FAD-linked reductases, N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 472-613
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000425
Family Glutathione peroxidase-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|128161|estExt_fgenesh3_pg.C_70044
Sequence length 616
Sequence
MTVGGEYHHRHPESTDICVIRTYCVIPHPTGTYHPHLSSRSHSIDPFVFRYYLSMSVTQP
LSVLVVGAGPSGLVSALSLVQHGIQVRVVDRDQQFHMGQRGAGIQPRTLEAYNLLGVLPD
IVSRGIDLRPMRFYKLPGGVEPSKTFDMMPIEEPTPSTPYMNTWMLGQAKAEQVLREHLA
TYGCHVERGTELSSFEQNTEHVVAHLVKRDGDEEIAETVVCRWLVGTDGARGIVRKHLNL
TFLGEALSGKGVFGEIVVKNLTRDYWHCWGDFTSKIVILRPTEDDEIYTFILSGNVDLEE
AYENYDTLVQIMKEVSNRQDLIFGEIKWKSNFSPNVRMVNKFSEGRVFVAGDAAHVHSPS
GAQGMNSSVQDALNLGWKLALVERGFAPQSLLNTYTEERLPVIAHMLKQTTNLFKTTRDP
AAHGGDASQAWTRPRDMKMLGVNYRWSSIVLNERHPQEVTEKDKHLLDAYGADASGGLHA
GDRAPDAPGLALVEEGNVGSETTSLFRIFSSTRHTVLIFSSDGDEIAAVLKSVQRLSSRL
VRAVIVVPRGLAGLPIVSSADGVYVDRDGHGYAGYGAGHEGITVAVVRPDGVVGALVSGA
TGLEAYFRSVLSGSNA
Download sequence
Identical sequences 104341.JGI128161 jgi|Pospl1|128161|estExt_fgenesh3_pg.C_70044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]