SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|129128|estExt_fgenesh3_pg.C_170113 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|129128|estExt_fgenesh3_pg.C_170113
Domain Number 1 Region: 10-191,286-375
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.25e-44
Family FAD-linked reductases, N-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 414-591
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.27e-23
Family Glutathione peroxidase-like 0.0032
Further Details:      
 
Domain Number 3 Region: 194-292
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.06e-19
Family PHBH-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|129128|estExt_fgenesh3_pg.C_170113
Sequence length 622
Sequence
MPARNTPRTVDVVVVGGGPTSLITSFILAKNGVDVMIVEQYEREEQAMYGRACVLYPRSL
ELLDLNGLYEHMADMGFIIRDSVTINDGKVVPGRGWHFVQDVINGHCCLDFCLNLRQKYV
EDAVKSALDQVNPKIFNAPVKFLNYTVDNSGTFPVTSTLHLQSGEFIHVRSKYLLGADGG
RSTVRSLSMIGFPGTMSPHKWVRLDAVVKTDMPCSRMTATAIESQEHGNVLWLPVDHGRT
RIGFVFPDELYGEEGKGVTVDMVMEEAKKALRPNSLEFVTLDWWTVYAIGQRVAEKFRDG
PVLLVGDAAHTHSSGSAQGMNTGIHDSTNLAWKLAGVIKGWYKEDVLDTYSTERRASAQR
LIELDRDVAALISGKIPDRFQAPPGSDANEYLDRVFRESAGFTVGLGISYAKNVLNRAHA
WERQPTSVPVGHRAPDARVYRHGSPVPRRLYELAASYGRRFTLLVFAGEVQPEGDATRLN
RPCAEKYRALRHYMDSPGAFSRNLADVFQLLTILRGEGTLQVSETLGALPLGRAVHDLSG
EAYAQYGVDAREGALVALRPDGIVGCVAPLDGWSALANYFGEFVHPAVQRAQKAVKKDVS
FAVGELSVEGQEETHAVLQRSK
Download sequence
Identical sequences jgi|Pospl1|129128|estExt_fgenesh3_pg.C_170113 104341.JGI129128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]