SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|130045|estExt_fgenesh3_pg.C_520055 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|130045|estExt_fgenesh3_pg.C_520055
Domain Number 1 Region: 54-215,324-405
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.77e-30
Family FAD-linked reductases, N-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 435-576
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000313
Family Glutathione peroxidase-like 0.0088
Further Details:      
 
Domain Number 3 Region: 275-329
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000102
Family PHBH-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|130045|estExt_fgenesh3_pg.C_520055
Sequence length 1400
Sequence
MIGRRPVCDSALLGQGLPRHYFLKEQNVTYHRGVSEPQHSRLNDPPMAHISYADVLVVGA
GPAGLMMAGCLAHLNVNVRIIDHRLSDEFAGHADGIQPRTIEIWESLGIADALKRVGRQT
HRLVTYQANEDSTGIKVSYLKINAAIPLFTQRQIIAHPEDIEKILRDELVNHGIHIQQPV
VPVNLCVSADRNEDGDYPVACTYLDEERLRTHVVPVNARDDCAQKPEYTQRQELVRAKCT
LLGTQTMRNLNGGQPSWYVSVLLLHYLSFLHPEGLTWGVMDFIPDTNFPTTQAKNIIQSP
LTGILGIIERGFLPYSMKAKEITWCSQYKGHIHSPNAGQGANVSMSDAYNLAWKLAYALS
GQATGRILDTYEEERRPCSIELINLDKELHKLNRPDSLFANEYVNVHFGARLIQGQNLFT
TGIGLEYRSRLTVEGFQSLAPGLPLGQRLPPGDILRCSDWNPCNLHDLIRYTLPFKVIVF
PGNLLEAVVSTRLSDFATSITTSLDDTKQSIIEMSVILRSSKYALPQVPDLPDMLSDSRL
YLDDDEHTSEPEWQDRLHGTLGISEEGVATLVDNHISRPRKSLPPAVRHFLADIFKLAPA
LPEKQPLDVVLTGSTVTAHGRSPPKASLTTRPACIALQNEDRDEDAVVITSLNVIPFCCH
ADLLTMSRAELVVVADTLNARLPRILSIDVGRSRSAAYIRKSIELLVGLRKDATQTPEAE
RSRSVFTGVGEVSHSAGSPRLLDNATQQDASTGSVALEDSQEGFRDPDVASHRPQKKRRF
DAEATVEASDRPMISRPITRSQSHRVGSVHPNSPLRNDITNRVLRTRSQNLPARKPMLKG
IHPNITVARGRSSSRPLGYLHSQSTVMTSTPKGRRSLGVGLVQPPRSPDGDSASASLTSN
LASPIVEKVKRTLKRKLDQTPQDTTDLTFGIEGLTMPPTASASDMHSGTVHLWVVAEQLG
LSNHAEWFGLEVGGFNAYTSHNIDAFCSVSATYEPLVKSILRHRLLYKILLPSFGYAWAL
TTVWSLWSQGGLPRLGLLGTFTNILKPTTLTYASALWLFGVLPAIVLRNRYLTAPAPAPA
PPKPEPTLPATPLKLLRTSVLKPTPTSPLRAALDTLASDGAISSAADSGVSQIPELFRSM
VHASPSAEKAIESVKRSEERVVGMFEETRTKLQQRMEAAVHGRVPAAALEKMTPAFGVVE
RVRQWWTRDRVNKLVEMSLPNRHLDALAISILSRLTCASLTEDSYGVVQRDIPKIIEALL
SFLAAVEEYQAEISKTHVTPSPEELQNMSAKERQEKERLMTELEQAGQIFAEVNDGLKEG
IVHIVRTFGDKLAAFRFPPRIAQKLQGVMAGNPYRTDTCFTMMWSLFYVHKLQNGKAGAG
YARRNGAYVWVHRLTSIATS
Download sequence
Identical sequences 104341.JGI130045 jgi|Pospl1|130045|estExt_fgenesh3_pg.C_520055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]