SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|27523|gw1.291.7.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|27523|gw1.291.7.1
Domain Number 1 Region: 27-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000358
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|27523|gw1.291.7.1
Sequence length 130
Sequence
KALLGPSKLSKVLENLNKAPRPQLEAIKSLKLTYAQRNDHFGARHFVKEDLPRIRFVNPD
MEIRVNKLPRAPEHKWQPEMVVEFRDGTSRTLNMDQKWSSAIFQELMDLGGGSPWLRWKK
ERAAAGLPVV
Download sequence
Identical sequences B8PMW4
XP_002477020.1.31404 104341.JGI27523 jgi|Pospl1|27523|gw1.291.7.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]