SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|43209|e_gw1.29.27.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|43209|e_gw1.29.27.1
Domain Number 1 Region: 265-319
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000244
Family PHD domain 0.023
Further Details:      
 
Domain Number 2 Region: 87-131
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000871
Family Myb/SANT domain 0.021
Further Details:      
 
Domain Number 3 Region: 175-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000618
Family Erythroid transcription factor GATA-1 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|43209|e_gw1.29.27.1
Domain Number - Region: 395-426
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000266
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|43209|e_gw1.29.27.1
Sequence length 591
Sequence
DLEERGGDSTIEVLCLANEMRPEEVETHRNTLTRNEDIKCNVDWLTEVMRRYTEARLAVR
DFGTVSMKNPLRLEKWKKRETRCIDRDWTDGEIAAFEDAIAVHGAELRPVRDEVGTKTMP
EVVRFYAHWKNSKLREENARIKAARESGLDAIELPSRAVSPDDEGSIVKELTRGNTSCGC
CRTRESTVWWRAPKGLPTNVLCDNCGLSWRKYADLNVRPYREDAMAKNKLENKREGTPLS
GPANKRAKTTPSGTSTPPPAGPVPAAPQHRCLACHKSGSIGKVLRCRQCQFRAHAGVCGV
VVDAAAVESWVCELCANEKTLEALLNPDCLLCPRSTRDPKRKSLYPPPDSFLRACKPTEG
QAWVHVLCSAFIPEVSYSDASRLRLVEGISTIPQYRWQNECTICSQNGGAVVRCAECPAE
YHVSCAWKQGYKFGFEMQPVRQSRRDTTTIVEFNDISGCMTPVVICKGHIGHKRELFDIC
ATNELGETALQVYCKNYKQVSTEHTHGLLRKARRLDNIITINGDHSSVGDDATSDPKCFR
CRSEFSPFFHPVPHTNGMSTCSAADTRTFLCHRCFIDTRENHVVTNGTASS
Download sequence
Identical sequences 104341.JGI43209 jgi|Pospl1|43209|e_gw1.29.27.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]