SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|52167|e_gw1.15.99.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|52167|e_gw1.15.99.1
Domain Number 1 Region: 184-236
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000121
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 2 Region: 31-115
Classification Level Classification E-value
Superfamily RING/U-box 0.000000153
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|52167|e_gw1.15.99.1
Domain Number - Region: 121-176
Classification Level Classification E-value
Superfamily RING/U-box 0.018
Family IBR domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|52167|e_gw1.15.99.1
Sequence length 278
Sequence
DAELVKEMEWVQLRLQEEPSAQAADQGEEDEENSIECGCCFSIYPFEKMIQCPEAHLFCT
DCIISYASTLLGSHDARIACMDQSGCKELFPESELRRVLPPKLVGLYDRVCQRRDIEAAG
LENLEECPFCEYKCVIDNPQEKLFRCENADCMAVTCRECKKADHLPRSCKEVEEDKKLDV
RHAIEEAMTRALMRNCPKCSKAFIKEQGCNKMTCPNCATMSCYICRKVVTGYYHFSNVSA
YRLILDSPAYMYSLPASPVHRTSKSKKVPVMGSRRAAT
Download sequence
Identical sequences 104341.JGI52167 jgi|Pospl1|52167|e_gw1.15.99.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]