SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|55607|e_gw1.91.17.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|55607|e_gw1.91.17.1
Domain Number 1 Region: 213-313
Classification Level Classification E-value
Superfamily RING/U-box 1.13e-25
Family Zf-UBP 0.0053
Further Details:      
 
Domain Number 2 Region: 177-230
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000309
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|55607|e_gw1.91.17.1
Domain Number - Region: 405-492
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00243
Family Myosin rod fragments 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|55607|e_gw1.91.17.1
Sequence length 524
Sequence
PFSATFIPRPAPNQISGTTHLPGGVVHIYRDNLTSADAPESIPVSQSHNGSQPQGSSTET
DPCSTGLVLAVLAVPSWMTPSDFLAFVAPAAEGIALLRMIRDSAPNRSLVLLKFREVIQA
TEFAEVYNGKSFNSMEAEICHVVRVASVVIDSDDSLSHQFTKLSLSHEPGSVYELPTCPV
CLERMDAAVTGLVTVPCSHTFHCACLSKWGDSRCPVCRYSQTLLSSHPPPTGTRSQHIPF
SLASTATQCTDCGSTGNLWICLICGNVGCGRYGRAHAHAHYTRTTHLYALELETQRVWDY
AGDGYVHRLIQNKADGKLVELPSAAIGINGSRAGGESAGPSAADALSAEKIEAIGIEYSY
LLTSQLDSQRVFYEEKTTELQVQIETLRGLVEGLSSDLEAEKVTRCENEAKIMANEKARH
VELEGEVVRLQTKMQKTTTLAQKLAKELQDERAVSKGLMENLQKSKQQAQQAMKEKTEAQ
NKVKDLEEQLRDIMFYLEARNGIETSGGLMSEAAGGSIVLGRHA
Download sequence
Identical sequences 104341.JGI55607 jgi|Pospl1|55607|e_gw1.91.17.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]