SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|58452|e_gw1.38.38.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|58452|e_gw1.38.38.1
Domain Number 1 Region: 211-276
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.89e-19
Family DNA-binding domain from rap30 0.0028
Further Details:      
 
Domain Number 2 Region: 39-142
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000105
Family Rap30/74 interaction domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|58452|e_gw1.38.38.1
Sequence length 312
Sequence
MDGPAIEEDSKQFDSVNAPQEDETQPDPDEEMIIENMAPGRVWLIPKHLMERWSSINQED
IQLATIRVYHEAVAANGKKPRIMMMLPPNPDGTCDEYELDMVNESVENQIVVAEREKYPG
VPHRARTTILTGRVKHECNLRPLFTERYRQRLKQRTLLANTPKKQIMRIEEAGIGGRGSI
NMLTSGAANQRPFTFGQVKQKPAKGQFERMARMPRNNLLDLLFGLFKEREFWSIKVLREK
TQQPEAWLKELLSGIAMLHRSGEHNGMWELNTNYKGRDDVEEMKLEDEAEGEDDDDDDEN
FDEDDDDMEEVS
Download sequence
Identical sequences jgi|Pospl1|58452|e_gw1.38.38.1 104341.JGI58452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]