SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|60811|e_gw1.12.111.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|60811|e_gw1.12.111.1
Domain Number 1 Region: 199-587
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.8e-52
Family Cellulases catalytic domain 0.093
Further Details:      
 
Domain Number 2 Region: 17-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.7e-30
Family Thioltransferase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|60811|e_gw1.12.111.1
Sequence length 743
Sequence
MSSSTHSVLGGAAGSRARNRLAQAKSPYLLQHADNPVDWYEWCSEAFEKARKEDKLIFLS
VGYSACHWCHVLAHESFEDEVTAKIMNEHYVNIKVDREERPDVDRLYMTFLQATTGGGGW
PMSVWLTPDLHPFFAGTYFPPGQFRQVLMKLADMWETDPDRCKAAGKQMIEQLREMTNVQ
SGSHDLPITSLASSIYSRLAKRFDPKYGGFGGAPKFPQPAQTTHFLARYAALNLDHIAGS
AGRSTISDQNKDMAVYTLVQIYKGGIHDVVGGGFARYSVDEKWHVPHFEKMLYDQGQLLA
SAVELALILPESSPSRGVLTDFARSILKYLPRHLTSPDGGFYSAEDADSLPAPQSKHTKE
GAFYTWTAQELRDVLGTDSEILEWMYGVKMDGNCDPAHDIQGELTGQNVLYVAHEVEEAA
NKFGRPVEILQQHLEQCLEKLRLYREEKRPRPHLDDKILTAWNGLMISGLAKASELLRGE
EAIQALSLAAKSTAFLRSHVYSEASGELVRSWREGPGPKGQADDYAFLIQGLLDLHEASG
KEEYITWAVRLQEKQDELFFDKEGGGYFASAPDEHILLRMKDAQDGAEPSAVSVTLSNLL
RLAHFAEDRHKEYQEKANSVLAANAQLLGAAPFALATMVSAAMLTERGLKQFILTETPSA
PRHSPFLDVIRERFIPNRVLIHIDPAHPPRSLARANATLRTLIEDLDKNKGVDVATTVPS
VHICENFTCGLPIKSVEKLKSIL
Download sequence
Identical sequences jgi|Pospl1|60811|e_gw1.12.111.1 104341.JGI60811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]