SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|62234|e_gw1.6.208.1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|62234|e_gw1.6.208.1
Domain Number 1 Region: 9-188,292-372
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.48e-49
Family FAD-linked reductases, N-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 431-589
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.92e-19
Family Glutathione peroxidase-like 0.0025
Further Details:      
 
Domain Number 3 Region: 191-289
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.32e-17
Family PHBH-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|62234|e_gw1.6.208.1
Sequence length 642
Sequence
MSATAHPAKVDVLLVGGGPTALITAYLLLKAGLSVSVIERYNKAEQAMYGRACMLYSRSV
ELLDQIGIFDRIADIGYFVRDSTTFKDGIEIPARGWSFVREAAKGKTYFDFSIRQKHIED
TLRAAIAEMDPTAVHAPATLTALAVVKSNDHPVQATVEENGSASVVQCKYIIGADGGRST
VRSLTQIAFPGTESKHRWVRLDAVVRSDIPIGRKQSAAIESHEYGNVLWTPTDNGRTRIG
FVLRDEVYDTLGGIITAEVIESEARKAVQPFSLEFVQLDWWTVYKIGQRVADTFKQGPVF
LAGDAAHTHSSGAAQGMNTGIHDAINLAWKLAGVLRGWLSEAVLDTYDAERRTSAQHLIQ
LDRDVAALISGKIPDHFNAPPDADVNVYLDRVFTENASFTIGLGISYASNVLNKPSSISV
PSLVPSPMDALIGHRAPDVILYRPGPAIPRRLQELTRYVGRFWILIFAGAIESSPTDVCL
TASCAEKYANLTRYITSDVSFLSTLAPMFSFLTIVHGSGALQSAEALGTKPLGKTAYDPT
GEAYAKYSIEPSEGAIVIVRPDGIVGFRASLDGGSDVTDYFSAFLKPAKAGPDRAQSAMT
WVLGEISLEDQENDVMIPTQGELNMSHASFVALTGVIVVSRS
Download sequence
Identical sequences jgi|Pospl1|62234|e_gw1.6.208.1 104341.JGI62234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]