SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|89525|fgenesh3_pm.68__5 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|89525|fgenesh3_pm.68__5
Domain Number 1 Region: 5-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.14e-36
Family spliceosomal protein U5-15Kd 0.000000925
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|89525|fgenesh3_pm.68__5
Sequence length 142
Sequence
MSYFLPHLPSGWHVDEAIKSEEDRVVVIRFGHDWDSQCMTMDETLYSVAEKVQNFAVIYL
VDITEVPDFNKMYELYDPCTVMFFYRNKHIMIDLGTGNNNKINWAMDNKQELIDIIETVY
RGASKGRGLVVSPKDYSTRYRY
Download sequence
Identical sequences A0A067SKZ0 A0A165BZZ7 A0A1X6N2P1 A0A2H3J7Z6 B8PBA9 F8P2C5 F8Q3F1
jgi|Serla_S7_9|472259|estExt_fgenesh2_kg.C_91380 jgi|Pospl1|89525|fgenesh3_pm.68__5 jgi|Pospl1|98595|fgenesh3_pg.276__5 104341.JGI89525 104341.JGI98595 jgi|Wolco1|27502|fgenesh1_kg.10_#_241_#_isotig11417 XP_002472973.1.31404 XP_007320543.1.27812 jgi|Galma1|127111|estExt_Genewise1.C_260246 jgi|Galma1|794020|CE509817_23525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]