SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|90902|fgenesh3_pg.29__10 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|90902|fgenesh3_pg.29__10
Domain Number 1 Region: 10-219,350-442
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.23e-47
Family FAD-linked reductases, N-terminal domain 0.0000942
Further Details:      
 
Domain Number 2 Region: 479-653
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.99e-37
Family Glutathione peroxidase-like 0.00022
Further Details:      
 
Domain Number 3 Region: 241-335
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.02e-25
Family PHBH-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|90902|fgenesh3_pg.29__10
Sequence length 654
Sequence
MPISLTKESDVDVLIIGAGPAGLMCAMALSHAGVNVRIIDQRPAKVTAGQADGIQPRIVE
VFQDLGTSVVLQSYGLADRLFKEAVQVHMAAFYNPSPHGGIERTDRAADVTAPTARWPFE
MALHQGGIEQIFLDSMASKGVHVERPIMPTFIELSQNETELRDPSSHPAKVVLKHLEVPE
GKSDTEIVYAKFVVGCDGPRDNLVSSGAHSWIRKEFGITMEGEQTDLGPKASSDIADIGK
SDYIWGVLDLIPDTDFPDIRNRCAVHSHNGSCMIIPREGDKVRLYIQLADQDVLDSKGRV
DKSKVGPEKIMEVANKSLYPYVMSTSHPIDWWTLYISTVSPFVVIQKLTCAIVGQRVANK
YSVHERVLIAGDACHTHSPKAGQGMNASMNDTHNLAWKLAHVLRGWADISLLKTYEFERR
KYAQDLISFDKRFAALFSGKPRTEGSEDGVTHEEFMEAFQTFGLFTSGIGVHYQPSTIVN
PKHQSVASNLLIGQRMLPHVFVRAADCQPMEMQDLLPADARFKVVVFTGDTTDQVQLKKV
RALAEEMDKPEGFLKRFGKSNGSAFDVISVSSAKKKYSNYTDAPPLFRSHWSKFLLDDQD
MYKRTSAGGGYEAYGIDPHGAIVIVRPDGYIGMVAPFDHLLDIDNYFASFMVPA
Download sequence
Identical sequences A0A1X6N7K3 B8P5N9
104341.JGI90902 XP_002470992.1.31404 jgi|Pospl1|90902|fgenesh3_pg.29__10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]