SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|91254|fgenesh3_pg.558__1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|91254|fgenesh3_pg.558__1
Domain Number 1 Region: 319-359
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000083
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 2 Region: 192-245
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000546
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|91254|fgenesh3_pg.558__1
Sequence length 385
Sequence
MAGAVTSTLLRPYLHILSYLGLEVLSLRARVLDIESQNGYLTADNERLSGEVSRLEDEVA
ELKAQSQTQIFVQDKSYRNVSRTFDVARDSQSQKGKGREVYVPHTSTNEVDSKQFIPPRR
QIEGSHASSSRRAGSAFYDPMYDHDFALAAALQAEQMPSQDGAYAASMQREFDGEDARLK
AQMTTLKHTAPGIFECGICLEEFNVDVVARIDICGHQFCRTCILGHTAAKIDERRYPIVC
PICMADKGLKKQGDKQYEVFVEMQLAAFSVILHCRKCKNTVFVDKSEHAATEILKIEFGG
PKHSCDGSSELKHLMQQRGWKYCPGCKTPAEKIDGCNHMTCMSPGCNTHFCYVCGEAITQ
SALRSEIKSALSAHYRRCRLFEDVA
Download sequence
Identical sequences B8PP11
104341.JGI91254 XP_002477417.1.31404 jgi|Pospl1|91254|fgenesh3_pg.558__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]