SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|96936|fgenesh3_pg.712__2 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|96936|fgenesh3_pg.712__2
Domain Number 1 Region: 203-258
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000801
Family RING finger domain, C3HC4 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|96936|fgenesh3_pg.712__2
Sequence length 305
Sequence
MHFSKTYQQLLLTLPVELRDSAIEYRKLKKLINKVVNELNSIGLSPDVLQEVLGQGDIST
TRTIRVNDHEVKVIYELSNVADHIEPRLRLIGSQEALGSPSSPRSASLPGALDAATDEES
IAVTLPPGEGAGEDSTAVSVEEIITPSALSSLLQENVAPDTHEIIIPLVSDTAFYQLLTQ
ALQYLNAKLAVAIGENLLPIIPHIDDYACLICTNIAFKPIRLSCGHLFCVRCLVKMQKRG
QGHCPMCRAPNVLSADRSNVDWALLNFMQDWFPVESKQKLRQNEKEVAEEEWEELGIEVG
NCVVM
Download sequence
Identical sequences B8PPA9
jgi|Pospl1|96936|fgenesh3_pg.712__2 104341.JGI96936 XP_002477514.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]