SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|97641|fgenesh3_pg.109__59 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|97641|fgenesh3_pg.109__59
Domain Number 1 Region: 18-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000001
Family Glutathione peroxidase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|97641|fgenesh3_pg.109__59
Sequence length 151
Sequence
MTTLSLDSSTIASVSKLPVYDATGKAFDFGSLYHGEKTIVVFIRWHFFCGQYVMELAKVP
QEALRQAAIRLVVIGCGDWHPIQDYCDITGYKGDMFADPSRALYQCLGLTESLERTPAGQ
EKRSYLAGRSFLGNLVRSIWNNRVSDNRKDR
Download sequence
Identical sequences A0A1X6NEE4 B8PF69
XP_002474312.1.31404 jgi|Pospl1|97641|fgenesh3_pg.109__59 104341.JGI97641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]